Structure of PDB 1omh Chain A Binding Site BS01

Receptor Information
>1omh Chain A (length=282) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLSHMVLTRQDIGRAASYYGDASEWQGKGAEELGLSGEVDSKRFRELLAG
NIGEGHRIMRSATRQDSKERIGLDLTFSAPKSVSLQALVAGDAEIIKAHD
RAVARTLEQAEARAQARQKIQGKTRIETTGNLVIGKFRHETSRERDPQLH
THAVILNMTKRSDGQWRALKNDEIVKATRYLGAVYNAELAHELQKLGYQL
RYGKDGNFDLAHIDRQQIEGFSKRTEQIAEWYAARGLDPNSVSLEQKQAA
KVLSRAKKTSVDREALRAEWQATAKELGIDFS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1omh Recognition and processing of the origin of transfer DNA by conjugative relaxase TrwC.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		M1 L2 S3 H4 M5 V6 S72 A73 R75 Q76 K79 R81 S89 A90 P91 K92 R128 Q129 K130 I131 Q132 R154 Q159 R172 R178 A179 N182 D183 N218 R226 S233 R235 T236 K258 K262 R266
Binding residue
(residue number reindexed from 1)		M1 L2 S3 H4 M5 V6 S61 A62 R64 Q65 K68 R70 S78 A79 P80 K81 R117 Q118 K119 I120 Q121 R143 Q148 R161 R167 A168 N171 D172 N207 R215 S222 R224 T225 K247 K251 R255
Binding affinityPDBbind-CN: Kd=70nM
Enzymatic activity
Enzyme Commision number ?
External links