Structure of PDB 1om2 Chain A Binding Site BS01

Receptor Information
>1om2 Chain A (length=95) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVC
GQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLGEDDVE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1om2 Structural basis of presequence recognition by the mitochondrial protein import receptor Tom20.
ResolutionN/A
Binding residue
(original residue number in PDB)		L21 I24 Q25 E28 E29 V59 T63
Binding residue
(residue number reindexed from 1)		L21 I24 Q25 E28 E29 V59 T63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006605 protein targeting
GO:0006886 intracellular protein transport
Cellular Component
GO:0005742 mitochondrial outer membrane translocase complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1om2, PDBe:1om2, PDBj:1om2
PDBsum1om2
PubMed10721992
UniProtQ62760|TOM20_RAT Mitochondrial import receptor subunit TOM20 homolog (Gene Name=Tomm20)

[Back to BioLiP]