Structure of PDB 1ol5 Chain A Binding Site BS01

Receptor Information
>1ol5 Chain A (length=265) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKA
GVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYREL
QKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKI
ADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEF
LVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRP
MLREVLEHPWITANS
Ligand information
>1ol5 Chain B (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SYSYDAPSDFINFSSNIDSWFEEKANLEN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ol5 Structural Basis of Aurora-A Activation by Tpx2 at the Mitotic Spindle
Resolution2.5 Å
Binding residue
(original residue number in PDB)		K125 R126 Q127 W128 E152 Q154 S155 F157 K166 L178 R179 V182 E183 S186 H187 L188 G198 Y199 V206 Y246 V252 H280 S387
Binding residue
(residue number reindexed from 1)		K3 R4 Q5 W6 E30 Q32 S33 F35 K44 L56 R57 V60 E61 S64 H65 L66 G76 Y77 V84 Y124 V130 H158 S265
Enzymatic activity
Catalytic site (original residue number in PDB) D256 K258 E260 N261 D274 T292
Catalytic site (residue number reindexed from 1) D134 K136 E138 N139 D152 T170
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0005524 ATP binding
Biological Process
GO:0000212 meiotic spindle organization
GO:0000226 microtubule cytoskeleton organization
GO:0000278 mitotic cell cycle
GO:0006468 protein phosphorylation
GO:0007052 mitotic spindle organization
GO:0007098 centrosome cycle
GO:0007100 mitotic centrosome separation
GO:0051321 meiotic cell cycle

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1ol5, PDBe:1ol5, PDBj:1ol5
PDBsum1ol5
PubMed14580337
UniProtO14965|AURKA_HUMAN Aurora kinase A (Gene Name=AURKA)

[Back to BioLiP]