Structure of PDB 1oj8 Chain A Binding Site BS01

Receptor Information

>1oj8 Chain A (length=105) Species: 8400 (Aquarana catesbeiana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EDWDTFQKKHLTDTKKVKCDVEMKKALFDCKKTNTFIFARPPRVQALCKN
IKNNTNVLSRDVFYLPQCNRKKLPCHYRLDGSTNTICLTCMKELPIHFAG
VGKCP

Ligand information

>1oj8 Chain B (length=4) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

acga

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1oj8 Retro and Novel Binding Modes in Cytotoxic Ribonucleases from Rana Catesbeiana of Two Crystal Structures Complexed with (2',5'Cpg) and D(Apcpgpa)
Resolution	1.7 Å
Binding residue (original residue number in PDB)	T14 K15 K16 Y64 T83
Binding residue (residue number reindexed from 1)	T14 K15 K16 Y64 T83

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0004519	endonuclease activity
GO:0004540	RNA nuclease activity

	Biological Process
GO:0050830	defense response to Gram-positive bacterium

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1oj8, PDBe:1oj8, PDBj:1oj8
PDBsum	1oj8
PubMed
UniProt	Q9DFY5

[Back to BioLiP]