Structure of PDB 1oeb Chain A Binding Site BS01

Receptor Information
>1oeb Chain A (length=59) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLGSVRWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLG
LFPANYVAP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1oeb Structural Basis for SH3 Domain-Mediated High-Affinity Binding between Mona/Gads and Slp-76
Resolution1.76 Å
Binding residue
(original residue number in PDB)		Y8 L13 E14 D16 E17 S35 W36 N51 Y52
Binding residue
(residue number reindexed from 1)		Y12 L17 E18 D20 E21 S39 W40 N55 Y56
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1oeb, PDBe:1oeb, PDBj:1oeb
PDBsum1oeb
PubMed12773374
UniProtO89100|GRAP2_MOUSE GRB2-related adaptor protein 2 (Gene Name=Grap2)

[Back to BioLiP]