Structure of PDB 1odh Chain A Binding Site BS01

Receptor Information
>1odh Chain A (length=157) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LSWDINDVKLPQNVKTTDWFQEWPDSYVKHIYSSDDRNAQRHLSSWAMRN
TNNHNSRILKKSCLGVVVCSRDCSTEEGRKIYLRPAICDKARQKQQRKSC
PNCNGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPRPETKLEA
EARRAMK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1odh Crystal Structure of the Gcm Domain-DNA Complex: A DNA-Binding Domain with a Novel Fold and Mode of Target Site Recognition
Resolution2.85 Å
Binding residue
(original residue number in PDB)		H55 N63 N65 H67 S69 L72 K74 I100 C101 K107 K160 R167 K170
Binding residue
(residue number reindexed from 1)		H42 N50 N52 H54 S56 L59 K61 I87 C88 K94 K147 R154 K157
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1odh, PDBe:1odh, PDBj:1odh
PDBsum1odh
PubMed12682016
UniProtP70348|GCM1_MOUSE Chorion-specific transcription factor GCMa (Gene Name=Gcm1)

[Back to BioLiP]