Structure of PDB 1odg Chain A Binding Site BS01

Receptor Information
>1odg Chain A (length=134) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AIEKRLASLLTGQGLAFRVQDASLPGRPDFVVDEYRCVIFTHGCFWHHHH
CYLFKVPATRTEFWLEKIGKNVERDRRDISRLQELGWRVLIVWECALRGR
EKLTDEALTERLEEWICGEGASAQIDTQGIHLLA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1odg Crystal Structure of the Escherichia Coli Dcm Very-Short-Patch DNA Repair Endonuclease Bound to its Reaction Product-Site in a DNA Superhelix
Resolution2.8 Å
Binding residue
(original residue number in PDB)		W68 P79 R82 W86 K89 K124
Binding residue
(residue number reindexed from 1)		W46 P57 R60 W64 K67 K102
Enzymatic activity
Catalytic site (original residue number in PDB) D51 T63 H69 D97
Catalytic site (residue number reindexed from 1) D29 T41 H47 D75
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006298 mismatch repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1odg, PDBe:1odg, PDBj:1odg
PDBsum1odg
PubMed12626704
UniProtP09184|VSR_ECOLI DNA mismatch endonuclease Vsr (Gene Name=vsr)

[Back to BioLiP]