Structure of PDB 1obx Chain A Binding Site BS01

Receptor Information
>1obx Chain A (length=74) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNV
IGLKDSQIADILSTSGTVVTITIM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1obx Molecular Roots of Degenerate Specificity in Syntenin'S Pdz2 Domain: Reassessment of the Pdz Recognition Paradigm
Resolution1.35 Å
Binding residue
(original residue number in PDB)		H208 V209 G210 F211 I212 F213 A255 L258
Binding residue
(residue number reindexed from 1)		H12 V13 G14 F15 I16 F17 A59 L62
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1obx, PDBe:1obx, PDBj:1obx
PDBsum1obx
PubMed12842047
UniProtO00560|SDCB1_HUMAN Syntenin-1 (Gene Name=SDCBP)

[Back to BioLiP]