Structure of PDB 1oai Chain A Binding Site BS01

Receptor Information
>1oai Chain A (length=59) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAKG
EIPEVAFMK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1oai Structural Basis for the Interaction between the Tap/Nxf1 Uba Domain and Fg Nucleoporins at 1 A Resolution
Resolution1.0 Å
Binding residue
(original residue number in PDB)		W584 K587 C588 D591 N592 N593 R598 A602 L606
Binding residue
(residue number reindexed from 1)		W24 K27 C28 D31 N32 N33 R38 A42 L46
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1oai, PDBe:1oai, PDBj:1oai
PDBsum1oai
PubMed12581645
UniProtQ9UBU9|NXF1_HUMAN Nuclear RNA export factor 1 (Gene Name=NXF1)

[Back to BioLiP]