Structure of PDB 1o9k Chain A Binding Site BS01

Receptor Information

>1o9k Chain A (length=194) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKE
KFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLN
DNIFHMSLLACALEVVMATYSRSSGTDLSFPWILNVLNLKAFDFYKVIES
FIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKD

Ligand information

>1o9k Chain P (length=18) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LDYHFGLEEGEGIRDLFD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1o9k Crystal Structure of the Retinoblastoma Tumor Suppressor Protein Bound to E2F and the Molecular Basis of its Regulation
Resolution	2.6 Å
Binding residue (original residue number in PDB)	E464 R467 L468 F482 K530 E533 S534 I536 K537 E554
Binding residue (residue number reindexed from 1)	E86 R89 L90 F104 K146 E149 S150 I152 K153 E170

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006357	regulation of transcription by RNA polymerase II
GO:0051726	regulation of cell cycle

	Cellular Component
GO:0005634	nucleus

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1o9k, PDBe:1o9k, PDBj:1o9k
PDBsum	1o9k
PubMed	12598654
UniProt	P06400\|RB_HUMAN Retinoblastoma-associated protein (Gene Name=RB1)

[Back to BioLiP]