Structure of PDB 1o9d Chain A Binding Site BS01

Receptor Information
>1o9d Chain A (length=230) Species: 4097 (Nicotiana tabacum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTAREENVYMAKLAEQAERYEEMVEFMEKVSNSLGSEELTVEERNLLSVA
YKNVIGARRASWRIISSIEQKEESRGNEEHVNSIREYRSKIENELSKICD
GILKLLDAKLIPSAASGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAEST
LTAYKAAQDIATTELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQA
FDEAIAELDTLGDSTLIMQLLRDNLTLWTS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1o9d Structural View of a Fungal Toxin Acting on a 14-3-3 Regulatory Complex
Resolution2.3 Å
Binding residue
(original residue number in PDB)		K56 R63 R67 R136 Y137 L181 N182 V185 E189 L229 N233 S239
Binding residue
(residue number reindexed from 1)		K52 R59 R63 R132 Y133 L177 N178 V181 E185 L220 N224 S230
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0007165 signal transduction
GO:0008104 protein localization
Cellular Component
GO:0005737 cytoplasm

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1o9d, PDBe:1o9d, PDBj:1o9d
PDBsum1o9d
PubMed12606564
UniProtP93343|1433C_TOBAC 14-3-3-like protein C

[Back to BioLiP]