Structure of PDB 1o9a Chain A Binding Site BS01

Receptor Information
>1o9a Chain A (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKPGCYDNGKHYQINQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETC
FDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANR
Ligand information
>1o9a Chain B (length=24) Species: 1334 (Streptococcus dysgalactiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
STTEVEDSKPKLSIHFDNEWPKED
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1o9a Pathogenic bacteria attach to human fibronectin through a tandem beta-zipper.
ResolutionN/A
Binding residue
(original residue number in PDB)		Y22 Y38 N41 G50 F54 N55 C56 E57 S58 Y70 W90 R99 R101 I102 S103 C104 T105 I106
Binding residue
(residue number reindexed from 1)		Y6 Y22 N25 G34 F38 N39 C40 E41 S42 Y54 W74 R83 R85 I86 S87 C88 T89 I90
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005576 extracellular region

View graph for
Cellular Component
External links
PDB RCSB:1o9a, PDBe:1o9a, PDBj:1o9a
PDBsum1o9a
PubMed12736686
UniProtP02751|FINC_HUMAN Fibronectin (Gene Name=FN1)

[Back to BioLiP]