Structure of PDB 1o4x Chain A Binding Site BS01

Receptor Information
>1o4x Chain A (length=129) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRF
EALNLSFKNMAKLKPLLEKWLNDAESIETNIRVALEKSFLENQKPTSEEI
TMIADQLNMEKEVIRVWFCNRRQKEKRIN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1o4x Molecular basis for synergistic transcriptional activation by Oct1 and Sox2 revealed from the solution structure of the 42-kDa Oct1.Sox2.Hoxb1-DNA ternary transcription factor complex.
ResolutionN/A
Binding residue
(original residue number in PDB)
Q48 T49 S52 R53 I111 W151 N154 K158
Binding residue
(residue number reindexed from 1)
Q44 T45 S48 R49 I77 W117 N120 K124
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:1o4x, PDBe:1o4x, PDBj:1o4x
PDBsum1o4x
PubMed14559893
UniProtP14859|PO2F1_HUMAN POU domain, class 2, transcription factor 1 (Gene Name=POU2F1)

[Back to BioLiP]