Structure of PDB 1o4x Chain A Binding Site BS01

Receptor Information

>1o4x Chain A (length=129) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRF
EALNLSFKNMAKLKPLLEKWLNDAESIETNIRVALEKSFLENQKPTSEEI
TMIADQLNMEKEVIRVWFCNRRQKEKRIN

Ligand information

>1o4x Chain C (length=19) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tgtctttgtcatgctaatg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1o4x Molecular basis for synergistic transcriptional activation by Oct1 and Sox2 revealed from the solution structure of the 42-kDa Oct1.Sox2.Hoxb1-DNA ternary transcription factor complex.
Resolution	N/A
Binding residue (original residue number in PDB)	Q48 T49 S52 R53 I111 W151 N154 K158
Binding residue (residue number reindexed from 1)	Q44 T45 S48 R49 I77 W117 N120 K124

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1o4x, PDBe:1o4x, PDBj:1o4x
PDBsum	1o4x
PubMed	14559893
UniProt	P14859\|PO2F1_HUMAN POU domain, class 2, transcription factor 1 (Gene Name=POU2F1)

[Back to BioLiP]