Structure of PDB 1o3t Chain A Binding Site BS01

Receptor Information

>1o3t Chain A (length=199) Species: 562 (Escherichia coli)

PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKE
MILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQV
NPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMT
HPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG

Ligand information

>1o3t Chain C (length=14)

gcgaaaaatgcgat

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1o3t Indirect Readout of DNA Sequence at the Primary-kink Site in the CAP-DNA Complex: DNA Binding Specificity Based on Energetics of DNA Kinking
• Resolution: 2.8 Å
• Binding residue (original residue number in PDB): T168 R169 Q170
• Binding residue (residue number reindexed from 1): T160 R161 Q162

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003680 minor groove of adenine-thymine-rich DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0005515 protein binding
• GO:0008301 DNA binding, bending
• GO:0030552 cAMP binding
• GO:0042802 identical protein binding
• GO:0043565 sequence-specific DNA binding

Biological Process

• GO:0006351 DNA-templated transcription
• GO:0006355 regulation of DNA-templated transcription
• GO:0045013 carbon catabolite repression of transcription
• GO:0045892 negative regulation of DNA-templated transcription
• GO:0045893 positive regulation of DNA-templated transcription

Cellular Component

• GO:0005829 cytosol
• GO:0032993 protein-DNA complex

External links

• PDB: RCSB:1o3t, PDBe:1o3t, PDBj:1o3t
• PDBsum: 1o3t
• PubMed: 11724532
• UniProt: P0ACJ8|CRP_ECOLI DNA-binding transcriptional dual regulator CRP (Gene Name=crp)