Structure of PDB 1nvp Chain A Binding Site BS01

Receptor Information
>1nvp Chain A (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPR
TTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNM
VGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSG
KVVLTGAKVRAEIYEAFENIYPILKGFRKT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1nvp Novel interactions between the components of human and yeast TFIIA/TBP/DNA complexes.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		V169 T171 F214 S216 K218 V220 Q256 N257 F288 R294 L303 T313
Binding residue
(residue number reindexed from 1)		V11 T13 F56 S58 K60 V62 Q98 N99 F130 R136 L145 T155
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006352 DNA-templated transcription initiation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1nvp, PDBe:1nvp, PDBj:1nvp
PDBsum1nvp
PubMed12972251
UniProtP20226|TBP_HUMAN TATA-box-binding protein (Gene Name=TBP)

[Back to BioLiP]