Structure of PDB 1ntv Chain A Binding Site BS01

Receptor Information

>1ntv Chain A (length=152) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVV
AGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITD
HRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEK
KA

Ligand information

>1ntv Chain B (length=10) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

NFDNPVYRKT

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1ntv Origins of Peptide Selectivity and Phosphoinositide Binding Revealed by Structures of Disabled-1 PTB Domain Complexes
Resolution	1.5 Å
Binding residue (original residue number in PDB)	R56 D58 H111 E112 I113 S114 Y115 I116 A117 G131 K132 I151 R155 F158
Binding residue (residue number reindexed from 1)	R34 D36 H89 E90 I91 S92 Y93 I94 A95 G109 K110 I129 R133 F136

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:1ntv, PDBe:1ntv, PDBj:1ntv
PDBsum	1ntv
PubMed	12737822
UniProt	P97318\|DAB1_MOUSE Disabled homolog 1 (Gene Name=Dab1)

[Back to BioLiP]