Structure of PDB 1npq Chain A Binding Site BS01

Receptor Information
>1npq Chain A (length=90) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLG
QNPTKCELDAIICEVDEDGSGTIDFEEFLVMMVRQMKEDA
Ligand information
>1npq Chain B (length=17) Species: 9986 (Oryctolagus cuniculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RMSADAMLRALLGSKHK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1npq NMR Structure of a Bifunctional Rhodamine Labeled N-Domain of Troponin C Complexed with the Regulatory "Switch" Peptide from Troponin I: Implications for in Situ Fluorescence Studies in Muscle Fibers
ResolutionN/A
Binding residue
(original residue number in PDB)		E21 F22 A24 A25 M28 V45 M46 M48 L49 M82
Binding residue
(residue number reindexed from 1)		E21 F22 A24 A25 M28 V45 M46 M48 L49 M82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:1npq, PDBe:1npq, PDBj:1npq
PDBsum1npq
PubMed12693929
UniProtP02588|TNNC2_CHICK Troponin C, skeletal muscle (Gene Name=TNNC2)

[Back to BioLiP]