Structure of PDB 1npo Chain A Binding Site BS01

Receptor Information
>1npo Chain A (length=81) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LELRQCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPC
QSGQKPCGSGGRCAAAGICCNDESCVTEPEC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1npo Crystal structure of the neurophysin-oxytocin complex.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		L7 C10 G23 P24 C44 E47 N48 L50 S52 P53 C54 Q55 D76
Binding residue
(residue number reindexed from 1)		L3 C6 G19 P20 C40 E43 N44 L46 S48 P49 C50 Q51 D72
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005185 neurohypophyseal hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1npo, PDBe:1npo, PDBj:1npo
PDBsum1npo
PubMed8564543
UniProtP01180|NEU2_BOVIN Vasopressin-neurophysin 2-copeptin (Gene Name=AVP)

[Back to BioLiP]