Structure of PDB 1nlt Chain A Binding Site BS01

Receptor Information

>1nlt Chain A (length=228) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PQRGKDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKKC
TSCNGQGIKFVTRQMGPMIQRFQTECDVCHGTGDIIDPKDRCKSCNGKKV
ENERKILEVHVEPGMKDGQRIVFKGEADQAPDVIPGDVVFIVSERPHKSF
KRDGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRK
VIEGKGMPIPKYGGYGNLIIKFTIKDPE

Ligand information

>1nlt Chain B (length=7) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GWLYEIS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1nlt The crystal structure of the yeast Hsp40 Ydj1 complexed with its peptide substrate.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	I116 H118 K134 L135 A136 L137 N138 D237
Binding residue (residue number reindexed from 1)	I7 H9 K25 L26 A27 L28 N29 D128

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0030544	Hsp70 protein binding
GO:0031072	heat shock protein binding
GO:0051082	unfolded protein binding

	Biological Process
GO:0006457	protein folding

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1nlt, PDBe:1nlt, PDBj:1nlt
PDBsum	1nlt
PubMed	14656432
UniProt	P25491\|MAS5_YEAST Mitochondrial protein import protein MAS5 (Gene Name=YDJ1)

[Back to BioLiP]