Structure of PDB 1nkk Chain A Binding Site BS01

Receptor Information

>1nkk Chain A (length=222) Species: 10359 (Human betaherpesvirus 5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DEQQSQAVAPVYVGGFLARYDQSPDEARLLLPRDVVEHWLHAQVALPLNI
NHDDTAVVGHVAAMQSVRDGLFCLGCVTSPRFLEIVRRASEKSELVSRGP
VSPLQPDKVVEFLSGSYAGLSLSSRRTTPFKHVALCSVGRRRGTLAVYGR
DPEWVTQRFPDLTAADRDGLRAQWQRGDPFRSDSYGLLGNSVDALYIRER
LPKLRYDKQLVGVTERESYVKA

Ligand information

>1nkk Chain E (length=4) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

VDNA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1nkk Structural and Biochemical Studies of Inhibitor Binding to Human Cytomegalovirus Protease
Resolution	2.6 Å
Binding residue (original residue number in PDB)	H63 S132 L133 S134 S135 R136 R137 G164
Binding residue (residue number reindexed from 1)	H52 S121 L122 S123 S124 R125 R126 G139

Enzymatic activity

Enzyme Commision number

3.4.21.97: assemblin.

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1nkk, PDBe:1nkk, PDBj:1nkk
PDBsum	1nkk
PubMed	12549906
UniProt	P16753\|SCAF_HCMVA Capsid scaffolding protein (Gene Name=UL80)

[Back to BioLiP]