Structure of PDB 1nh2 Chain A Binding Site BS01

Receptor Information
>1nh2 Chain A (length=180) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPK
TTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNI
VGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSG
KIVLTGAKQREEIYQAFEAIYPVLSEFRKM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1nh2 Novel interactions between the components of human and yeast TFIIA/TBP/DNA complexes.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		T73 F116 S118 K120 V122 Q158 N159 L189 F190 R196 T215
Binding residue
(residue number reindexed from 1)		T13 F56 S58 K60 V62 Q98 N99 L129 F130 R136 T155
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006352 DNA-templated transcription initiation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1nh2, PDBe:1nh2, PDBj:1nh2
PDBsum1nh2
PubMed12972251
UniProtP13393|TBP_YEAST TATA-box-binding protein (Gene Name=SPT15)

[Back to BioLiP]