Structure of PDB 1nb5 Chain A Binding Site BS01

Receptor Information
>1nb5 Chain A (length=220) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YPPSMDWRKKGNFVSPVKNQGSCGSCWTFSTTGALESAVAIATGKMLSLA
EQQLVDCAQNFNNHGCQGGLPSQAFEYIRYNKGIMGEDTYPYKGQDDHCK
FQPDKAIAFVKDVANITMNDEEAMVEAVALYNPVSFAFEVTNDFLMYRKG
IYSSTSCHKTPDKVNHAVLAVGYGEENGIPYWIVKNSWGPQWGMNGYFLI
ERGKNMCGLAACASYPIPLV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1nb5 Crystal structure of stefin A in complex with cathepsin H: N-terminal residues of inhibitors can adapt to the active sites of endo- and exopeptidases
Resolution2.4 Å
Binding residue
(original residue number in PDB)		N59 H61 L67 S69 Q70 C205
Binding residue
(residue number reindexed from 1)		N62 H64 L70 S72 Q73 C212
Enzymatic activity
Catalytic site (original residue number in PDB) Q19 C25 H159 N175
Catalytic site (residue number reindexed from 1) Q20 C26 H166 N186
Enzyme Commision number 3.4.22.16: cathepsin H.
Gene Ontology
Molecular Function
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1nb5, PDBe:1nb5, PDBj:1nb5
PDBsum1nb5
PubMed12581647
UniProtO46427|CATH_PIG Pro-cathepsin H (Gene Name=CTSH)

[Back to BioLiP]