Structure of PDB 1n7f Chain A Binding Site BS01

Receptor Information
>1n7f Chain A (length=86) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AIIYTVELKRYGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGD
RILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1n7f Crystal structure of GRIP1 PDZ6-peptide complex reveals the structural basis for class II PDZ target recognition and PDZ domain-mediated multimerization
Resolution1.8 Å
Binding residue
(original residue number in PDB)		P681 L682 G683 I684 T685 I686 S687 G688 T689 I736
Binding residue
(residue number reindexed from 1)		P14 L15 G16 I17 T18 I19 S20 G21 T22 I69
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1n7f, PDBe:1n7f, PDBj:1n7f
PDBsum1n7f
PubMed12493751
UniProtP97879|GRIP1_RAT Glutamate receptor-interacting protein 1 (Gene Name=Grip1)

[Back to BioLiP]