Structure of PDB 1n5n Chain A Binding Site BS01

Receptor Information

>1n5n Chain A (length=167) Species: 287 (Pseudomonas aeruginosa)

MAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLAAT
QVNVHKRIVVMDLSEDKSEPRVFINPEFEPLTEEMDQYQEGCLSVPGFYE
NVDRPQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYLST
LKRDRIRKKLEKQHRQQ

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 1n5n Chain A Residue 401

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1n5n Structure analysis of peptide deformylases from streptococcus pneumoniae,staphylococcus aureus, thermotoga maritima, and pseudomonas aeruginosa: snapshots of the oxygen sensitivity of peptide deformylase
• Resolution: 1.8 Å
• Binding residue (original residue number in PDB): C92 H134 H138
• Binding residue (residue number reindexed from 1): C92 H134 H138
• Annotation score: 1

Enzymatic activity

• Catalytic site (original residue number in PDB): G46 Q51 C92 L93 H134 E135 H138
• Catalytic site (residue number reindexed from 1): G46 Q51 C92 L93 H134 E135 H138
• Enzyme Commision number: 3.5.1.88: peptide deformylase.

Gene Ontology

Molecular Function

• GO:0016787 hydrolase activity
• GO:0042586 peptide deformylase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation
• GO:0043686 co-translational protein modification

External links

• PDB: RCSB:1n5n, PDBe:1n5n, PDBj:1n5n
• PDBsum: 1n5n
• PubMed: 12823970
• UniProt: Q9I7A8|DEF_PSEAE Peptide deformylase (Gene Name=def)