Structure of PDB 1n4h Chain A Binding Site BS01

Receptor Information

>1n4h Chain A (length=244) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TMSEIDRIAQNIIKSHLETCQYTMEELHQLAWQTHTYEEIKAYQSKSREA
LWQQCAIQITHAIQYVVEFAKRITGFMELCQNDQILLLKSGCLEVVLVRM
CRAFNPLNNTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNLCSLQLTEE
EIALFSSAVLISPDRAWLLEPRKVQKLQEKIYFALQHVIQKNHLDDETLA
KLIAKIPTITAVCNLHGEKLQVFKQSHPDIVNTLFPPLYKELFN

Ligand information

>1n4h Chain B (length=10) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

HKILHRLLQE

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1n4h All-trans retinoic acid is a ligand for the orphan nuclear receptor RORbeta
Resolution	2.1 Å
Binding residue (original residue number in PDB)	K71 Q81 I85 K89 P237 L238 E241
Binding residue (residue number reindexed from 1)	K71 Q81 I85 K89 P237 L238 E241

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1n4h, PDBe:1n4h, PDBj:1n4h
PDBsum	1n4h
PubMed	12958591
UniProt	P45446\|RORB_RAT Nuclear receptor ROR-beta (Gene Name=Rorb)

[Back to BioLiP]