Structure of PDB 1n39 Chain A Binding Site BS01

Receptor Information

>1n39 Chain A (length=314) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GSEGHRTLASTPALWASIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGV
LADQVWTLTQTEEQLHCTVYRSQASRPTPDELEAVRKYFQLDVTLAQLYH
HWGSVDSHFQEVAQKFQGVRLLRQDPIECLFSFICSSNNNIARITGMVER
LCQAFGPRLIQLDDVTYHGFPSLQALAGPEVEAHLRKLGLGYRARYVSAS
ARAILEEQGGLAWLQQLRESSYEEAHKALCILPGVGTKVADCICLMALDK
PQAVPVEVHMWHIAQRDYSWHPTTSQAKGPSPQTNKELGNFFRSLWGPYA
GWAQAVLFSADLRQ

Ligand information

>1n39 Chain B (length=15) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggtagacctggacgc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1n39 Structural and biochemical exploration of a critical amino acid in human 8-oxoguanine glycosylase
Resolution	2.2 Å
Binding residue (original residue number in PDB)	N149 R154 G202 Y203 R204 Q287
Binding residue (residue number reindexed from 1)	N138 R143 G191 Y192 R193 Q276

Enzymatic activity

Enzyme Commision number

3.2.2.-
4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.

Gene Ontology

	Molecular Function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003677	DNA binding
GO:0003684	damaged DNA binding
GO:0003824	catalytic activity
GO:0004519	endonuclease activity
GO:0005515	protein binding
GO:0008017	microtubule binding
GO:0008534	oxidized purine nucleobase lesion DNA N-glycosylase activity
GO:0016798	hydrolase activity, acting on glycosyl bonds
GO:0016829	lyase activity
GO:0019104	DNA N-glycosylase activity
GO:0019899	enzyme binding
GO:0032357	oxidized purine DNA binding
GO:0034039	8-oxo-7,8-dihydroguanine DNA N-glycosylase activity
GO:0140078	class I DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0140097	catalytic activity, acting on DNA

	Biological Process
GO:0006281	DNA repair
GO:0006284	base-excision repair
GO:0006285	base-excision repair, AP site formation
GO:0006289	nucleotide-excision repair
GO:0006355	regulation of DNA-templated transcription
GO:0006974	DNA damage response
GO:0006979	response to oxidative stress
GO:0009314	response to radiation
GO:0009410	response to xenobiotic stimulus
GO:0009416	response to light stimulus
GO:0032355	response to estradiol
GO:0034614	cellular response to reactive oxygen species
GO:0043066	negative regulation of apoptotic process
GO:0044029	positive regulation of gene expression via chromosomal CpG island demethylation
GO:0045007	depurination
GO:0045008	depyrimidination
GO:0045471	response to ethanol
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0051593	response to folic acid
GO:0071276	cellular response to cadmium ion
GO:1901291	negative regulation of double-strand break repair via single-strand annealing

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005739	mitochondrion
GO:0005759	mitochondrial matrix
GO:0005829	cytosol
GO:0016363	nuclear matrix
GO:0016607	nuclear speck
GO:0032991	protein-containing complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1n39, PDBe:1n39, PDBj:1n39
PDBsum	1n39
PubMed	12578369
UniProt	O15527\|OGG1_HUMAN N-glycosylase/DNA lyase (Gene Name=OGG1)

[Back to BioLiP]