Structure of PDB 1n12 Chain A Binding Site BS01

Receptor Information
>1n12 Chain A (length=138) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VPACTVSNTTVDWQDVEIQTLSQNGNHEKEFTVNMRCPYNLGTMKVTITA
TNTYNNAILVQNTSNTSSDGLLVYLYNSNAGNIGTAITLGTPFTPGKITG
NNADKTISLHAKLGYKGNMQNLIAGPFSATATLVASYS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1n12 Chaperone priming of pilus subunits facilitates a topological transition that drives fiber formation
Resolution1.87 Å
Binding residue
(original residue number in PDB)		V17 N19 T20 T21 V22 D23 W24 Q25 D26 V27 I29 L86 A135 G136 P137 F138 S139 A140 T141 A142 T143 L144
Binding residue
(residue number reindexed from 1)		V6 N8 T9 T10 V11 D12 W13 Q14 D15 V16 I18 L75 A124 G125 P126 F127 S128 A129 T130 A131 T132 L133
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0007155 cell adhesion
GO:0043709 cell adhesion involved in single-species biofilm formation
Cellular Component
GO:0005576 extracellular region
GO:0009289 pilus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1n12, PDBe:1n12, PDBj:1n12
PDBsum1n12
PubMed12437927
UniProtP08407|PAPE_ECOLX Fimbrial protein PapE (Gene Name=papE)

[Back to BioLiP]