Structure of PDB 1mzp Chain A Binding Site BS01

Receptor Information

>1mzp Chain A (length=217) Species: 2285 (Sulfolobus acidocaldarius) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MLADKESLIEALKLALSTEYNVKRNFTQSVEIILTFKGIDMKKGDLKLRE
IVPLPKQPSKAKRVLVVPSSEQLEYAKKASPKVVITREELQKLQGQKRPV
KKLARQNEWFLINQESMALAGRILGPALGPRGKFPTPLPNTADISEYINR
FKRSVLVKTKDQPQVQVFIGTEDMKPEDLAENAIAVLNAIENKAKVETNL
RNIYVKTTMGKAVKVKR

Ligand information

>1mzp Chain B (length=55) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gggaugcguaggauaggugggagccgcaaggcgccggugaaauaccaccc
uuccc

<<<<...........<<<<<..<<<....>>>............>>>>>.
.>>>>

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1mzp Structure of the L1 protuberance in the ribosome.
Resolution	2.65 Å
Binding residue (original residue number in PDB)	R24 N25 F26 S29 E31 T35 K60 K97 R98 K101 K102 R105 P130 R131 K158 Q162 Q164 Q166 R201 K206 T208 M209 G210
Binding residue (residue number reindexed from 1)	R24 N25 F26 S29 E31 T35 K60 K97 R98 K101 K102 R105 P130 R131 K158 Q162 Q164 Q166 R201 K206 T208 M209 G210

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation
GO:0006417	regulation of translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1mzp, PDBe:1mzp, PDBj:1mzp
PDBsum	1mzp
PubMed	12514741
UniProt	P35024\|RL1_SULAC Large ribosomal subunit protein uL1 (Gene Name=rpl1)

[Back to BioLiP]