Structure of PDB 1mxe Chain A Binding Site BS01

Receptor Information
>1mxe Chain A (length=144) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMIN
EVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAA
ELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTS
Ligand information
>1mxe Chain E (length=25) Species: 10116 (Rattus norvegicus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IKKNFAKSKWKQAFNATAVVRHMRK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mxe Structure of the Complex of Calmodulin with the Target Sequence of Calmodulin-Dependent Protein Kinase I: Studies of the Kinase Activation Mechanism
Resolution1.7 Å
Binding residue
(original residue number in PDB)		E11 E14 L18 F19 M36 Q41 E47 M51 M71 K75 E83 E84 I85 E87 A88 F92 L105 M109 E114 E119 E120 M124 E127 M144 M145 S147
Binding residue
(residue number reindexed from 1)		E8 E11 L15 F16 M33 Q38 E44 M48 M68 K72 E80 E81 I82 E84 A85 F89 L102 M106 E111 E116 E117 M121 E124 M141 M142 S144
Enzymatic activity
Catalytic site (original residue number in PDB) V35
Catalytic site (residue number reindexed from 1) V32
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0016247 channel regulator activity
GO:0030234 enzyme regulator activity
GO:0031489 myosin V binding
GO:0032036 myosin heavy chain binding
GO:0046872 metal ion binding
GO:0070855 myosin VI head/neck binding
Biological Process
GO:0007099 centriole replication
GO:0007605 sensory perception of sound
GO:0007608 sensory perception of smell
GO:0016056 G protein-coupled opsin signaling pathway
GO:0016059 negative regulation of opsin-mediated signaling pathway
GO:0016060 negative regulation of phospholipase C-activating phototransduction signaling pathway
GO:0030048 actin filament-based movement
GO:0042052 rhabdomere development
GO:0046716 muscle cell cellular homeostasis
GO:0048102 autophagic cell death
GO:0050911 detection of chemical stimulus involved in sensory perception of smell
GO:0051383 kinetochore organization
GO:0071361 cellular response to ethanol
GO:0072499 photoreceptor cell axon guidance
Cellular Component
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005814 centriole
GO:0005819 spindle
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005938 cell cortex
GO:0016028 rhabdomere
GO:0030496 midbody
GO:0031475 myosin V complex
GO:0031476 myosin VI complex
GO:0031477 myosin VII complex
GO:0072686 mitotic spindle
GO:0097431 mitotic spindle pole

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1mxe, PDBe:1mxe, PDBj:1mxe
PDBsum1mxe
PubMed12475216
UniProtP62152|CALM_DROME Calmodulin (Gene Name=Cam)

[Back to BioLiP]