Structure of PDB 1mwj Chain A Binding Site BS01

Receptor Information
>1mwj Chain A (length=165) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVEDILAPGLRVVFCGINPGLSSAGTGFPFAHPANRFWKVIYQAGFTDRQ
LKPQEAQHLLDYRCGVTKLVDRPTVQANEVSKQELHAGGRKLIEKIEDYQ
PQALAILGKQAYEQGFSQRGAQWGKQTLTIGSTQIWVLPNPSGLSRVSLE
KLVEAYRELDQALVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mwj Crystal Structure of a thwarted mismatch glycosylase DNA repair complex
Resolution2.85 Å
Binding residue
(original residue number in PDB)		G143 R146
Binding residue
(residue number reindexed from 1)		G143 R146
Enzymatic activity
Catalytic site (original residue number in PDB) N18 P29
Catalytic site (residue number reindexed from 1) N18 P29
Enzyme Commision number 3.2.2.28: double-stranded uracil-DNA glycosylase.
Gene Ontology
Molecular Function
GO:0000700 mismatch base pair DNA N-glycosylase activity
GO:0003677 DNA binding
GO:0004844 uracil DNA N-glycosylase activity
GO:0008263 pyrimidine-specific mismatch base pair DNA N-glycosylase activity
GO:0016787 hydrolase activity
GO:0043739 G/U mismatch-specific uracil-DNA glycosylase activity
Biological Process
GO:0006281 DNA repair
GO:0006285 base-excision repair, AP site formation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1mwj, PDBe:1mwj, PDBj:1mwj
PDBsum1mwj
PubMed10581234
UniProtP0A9H1|MUG_ECOLI G/U mismatch-specific DNA glycosylase (Gene Name=mug)

[Back to BioLiP]