Structure of PDB 1muj Chain A Binding Site BS01

Receptor Information

>1muj Chain A (length=185) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DIEADHVGTYGISVYQSPGDIGQYTFEFDGDELFYVDLDKKETVWMLPEF
GQLASFDPQGGLQNIAVVKHNLGVLTKRSNSTPATNEAPQATVFPKSPVL
LGQPNTLICFVDNIFPPVINITWLRNSKSVADGVYETSFFVNRDYSFHKL
SYLTFIPSDDDIYDCKVEHWGLEEPVLKHWSSADL

Ligand information

>1muj Chain C (length=15) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PVSKMRMATPLLMQA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1muj Crystal structure of MHC class II I-Ab in complex with a human CLIP peptide: Prediction of an I-Ab peptide-binding motif
Resolution	2.15 Å
Binding residue (original residue number in PDB)	Y9A Y22 F24 L51 A52 S53 F54 N62 V65 H68 N69 V72 L73 R76
Binding residue (residue number reindexed from 1)	Y10 Y24 F26 L53 A54 S55 F56 N64 V67 H70 N71 V74 L75 R78

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1muj, PDBe:1muj, PDBj:1muj
PDBsum	1muj
PubMed	12589760
UniProt	P14434\|HA2B_MOUSE H-2 class II histocompatibility antigen, A-B alpha chain (Gene Name=H2-Aa)

[Back to BioLiP]