Structure of PDB 1mms Chain A Binding Site BS01

Receptor Information
>1mms Chain A (length=133) Species: 2336 (Thermotoga maritima) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVV
ITVYEDKSFTFIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEE
IAKTKMPDLNANSLEAAMKIIEGTAKSMGIEVV
Ligand information
>1mms Chain C (length=58) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcugggauguuggcuuagaagcagccaucauuuaaagagugcguaacagc
ucaccagc
<<<<<.<<...<<<<.......>>>>...>>.........<<......>>
...>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mms A detailed view of a ribosomal active site: the structure of the L11-RNA complex.
Resolution2.57 Å
Binding residue
(original residue number in PDB)		K10 P74 A75 S76 K80 K87 G88 S89 S90 E91 P92 K93 R94 K112 D115 N117 A118 N119 A123 K126 I127 G130 T131 K133 S134 M135
Binding residue
(residue number reindexed from 1)		K3 P67 A68 S69 K73 K80 G81 S82 S83 E84 P85 K86 R87 K105 D108 N110 A111 N112 A116 K119 I120 G123 T124 K126 S127 M128
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1mms, PDBe:1mms, PDBj:1mms
PDBsum1mms
PubMed10338213
UniProtP29395|RL11_THEMA Large ribosomal subunit protein uL11 (Gene Name=rplK)

[Back to BioLiP]