Structure of PDB 1mjp Chain A Binding Site BS01

Receptor Information
>1mjp Chain A (length=104) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRKVNNLRH
ATNSELLCEAFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPE
TWEY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mjp Direct and indirect readout in mutant Met repressor-operator complexes.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		K17 K23 T52 N53 S54
Binding residue
(residue number reindexed from 1)		K17 K23 T52 N53 S54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006555 methionine metabolic process
GO:0009086 methionine biosynthetic process
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1mjp, PDBe:1mjp, PDBj:1mjp
PDBsum1mjp
PubMed10986458
UniProtP0A8U6|METJ_ECOLI Met repressor (Gene Name=metJ)

[Back to BioLiP]