Structure of PDB 1mfl Chain A Binding Site BS01

Receptor Information
>1mfl Chain A (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSMEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASK
LLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREVSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mfl Novel mode of ligand recognition by the erbin PDZ domain
Resolution1.88 Å
Binding residue
(original residue number in PDB)
E1290 L1291 F1293 S1294 I1295 T1316
Binding residue
(residue number reindexed from 1)
E14 L15 F17 S18 I19 T40
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1mfl, PDBe:1mfl, PDBj:1mfl
PDBsum1mfl
PubMed12444095
UniProtQ96RT1|ERBIN_HUMAN Erbin (Gene Name=ERBIN)

[Back to BioLiP]