Structure of PDB 1mf4 Chain A Binding Site BS01

Receptor Information

>1mf4 Chain A (length=119) Species: 195058 (Naja sagittifera)

NLYQFKNMIQCTVPSRSWADFADYGCYCGKGGSGTPVDDLDRCCQTHDNC
YNEAENISGCRPYFKTYSYECTQGTLTCKGDNNACAASVCDCDRLAAICF
AGAPYNDANYNIDLKARCN

Ligand information

>1mf4 Chain B (length=5)

VAFRS

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1mf4 Design of specific peptide inhibitors for group I phospholipase A2: structure of a complex formed between phospholipase A2 from Naja naja sagittifera (group I) and a designed peptide inhibitor Val-Ala-Phe-Arg-Ser (VAFRS) at 1.9 A resolution reveals unique features
• Resolution: 1.9 Å
• Binding residue (original residue number in PDB): K6 I9 W19 F22 G30 K31 C45 H48 D49 Y64
• Binding residue (residue number reindexed from 1): K6 I9 W18 F21 G29 K30 C44 H47 D48 Y63

Enzymatic activity

• Catalytic site (original residue number in PDB): Y28 G30 G32 H48 D49 Y52 Y68 D94
• Catalytic site (residue number reindexed from 1): Y27 G29 G31 H47 D48 Y51 Y67 D93
• Enzyme Commision number: 3.1.1.4: phospholipase A2.

Gene Ontology

Molecular Function

• GO:0004623 phospholipase A2 activity
• GO:0005509 calcium ion binding
• GO:0005543 phospholipid binding
• GO:0016787 hydrolase activity
• GO:0046872 metal ion binding
• GO:0047498 calcium-dependent phospholipase A2 activity

Biological Process

• GO:0006644 phospholipid metabolic process
• GO:0016042 lipid catabolic process
• GO:0050482 arachidonate secretion

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:1mf4, PDBe:1mf4, PDBj:1mf4
• PDBsum: 1mf4
• PubMed: 14529280
• UniProt: P60045|PA2A3_NAJSG Acidic phospholipase A2 3 (Fragment)