Structure of PDB 1mcd Chain A Binding Site BS01

Receptor Information

>1mcd Chain A (length=216) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVII
YEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFV
FGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTV
AWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVT
HEGSTVEKTVAPTECS

Ligand information

>1mcd Chain P (length=4) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

FAHP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1mcd Principles and pitfalls in designing site-directed peptide ligands.
Resolution	Å
Binding residue (original residue number in PDB)	Y38 Y93 D97 F99
Binding residue (residue number reindexed from 1)	Y38 Y93 D97 F99

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0002250	adaptive immune response

	Cellular Component
GO:0005576	extracellular region
GO:0005886	plasma membrane
GO:0019814	immunoglobulin complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1mcd, PDBe:1mcd, PDBj:1mcd
PDBsum	1mcd
PubMed	8346191
UniProt	P0DOX8\|IGL1_HUMAN Immunoglobulin lambda-1 light chain

[Back to BioLiP]