Structure of PDB 1m72 Chain A Binding Site BS01

Receptor Information

>1m72 Chain A (length=247) Species: 7108 (Spodoptera frugiperda)

RVARMPVDRNAPYYNMNHKHRGMAIIFNHEHFDIHSLKSRTGTNVDSDNL
SKVLKTLGFKVTVFPNLKSEEINKFIQQTAEMDHSDADCLLVAVLTHGEL
GMLYAKDTHYKPDNLWYYFTADKCPTLAGKPKLFFIQACQGDRLDGGITL
SRSYRIPVHADFLIAFSTVPGYFSWRNTTRGSWFMQALCEELRYAGTERD
ILTLLTFVCQKVALDFESNAPDSAMMHQQKQVPCITSMLTRLLVFGK

Ligand information

>1m72 Chain D (length=4)

DEVD

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1m72 Crystal structure of an invertebrate caspase.
• Resolution: 2.3 Å
• Binding residue (original residue number in PDB): K77 R79 H136 Q176 C178 F221 S222 W223 R224 N225 T226 S266 N267
• Binding residue (residue number reindexed from 1): K38 R40 H97 Q137 C139 F173 S174 W175 R176 N177 T178 S218 N219

Enzymatic activity

• Catalytic site (original residue number in PDB): K77 S78 H136 G137 C178 Q179
• Catalytic site (residue number reindexed from 1): K38 S39 H97 G98 C139 Q140
• Enzyme Commision number: 3.4.22.-

Gene Ontology

Molecular Function

• GO:0004197 cysteine-type endopeptidase activity
• GO:0008234 cysteine-type peptidase activity
• GO:0097199 cysteine-type endopeptidase activity involved in apoptotic signaling pathway

Biological Process

• GO:0006508 proteolysis
• GO:0006915 apoptotic process
• GO:0006919 activation of cysteine-type endopeptidase activity involved in apoptotic process
• GO:0043525 positive regulation of neuron apoptotic process
• GO:0097190 apoptotic signaling pathway

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:1m72, PDBe:1m72, PDBj:1m72
• PDBsum: 1m72
• PubMed: 14645217
• UniProt: P89116|CASP1_SPOFR Caspase-1