Structure of PDB 1m5x Chain A Binding Site BS01

Receptor Information

>1m5x Chain A (length=161) Species: 141716 (Monomastix sp. OKE-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TLQPTEAAYIAGFLDGDGSIYAKLIPRPDYKDIKYQVSLAISFIQRKDKF
PYLQDIYDQLGKRGNLRKDRGDGIADYTIIGSTHLSIILPDLVPYLRIKK
KQANRILHIINLYPQAQKNPSKFLDLVKIVDDVQNLNKRADELKSTNYDR
LLEEFLKAGKI

Ligand information

>1m5x Chain C (length=24) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gcagaacgtcgtgagacagttccg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1m5x Flexible DNA Target Site Recognition by Divergent Homing Endonuclease Isoschizomers I-CreI and I-MsoI
Resolution	2.25 Å
Binding residue (original residue number in PDB)	D22 G23 S24 Y26 K28 I49 Q50 R51 R75 N142
Binding residue (residue number reindexed from 1)	D17 G18 S19 Y21 K23 I44 Q45 R46 R70 N137

Enzymatic activity

Catalytic site (original residue number in PDB)	G21 D22
Catalytic site (residue number reindexed from 1)	G16 D17
Enzyme Commision number	?

Gene Ontology

	Molecular Function
GO:0004519	endonuclease activity
GO:0046872	metal ion binding

	Cellular Component
GO:0009507	chloroplast

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:1m5x, PDBe:1m5x, PDBj:1m5x
PDBsum	1m5x
PubMed	12758074
UniProt	C0JWR6

[Back to BioLiP]