Structure of PDB 1m4p Chain A Binding Site BS01

Receptor Information
>1m4p Chain A (length=144) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRE
LMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGK
HVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP
Ligand information
>1m4p Chain B (length=9) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PEPTAPPEE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1m4p Structure of the Tsg101 UEV domain in complex with the PTAP motif of the HIV-1 p6 protein
ResolutionN/A
Binding residue
(original residue number in PDB)		T58 Y63 Y68 N69 I70 P71 M95 V141 F142 S143
Binding residue
(residue number reindexed from 1)		T57 Y62 Y67 N68 I69 P70 M94 V140 F141 S142
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0015031 protein transport
GO:0036211 protein modification process

View graph for
Biological Process
External links
PDB RCSB:1m4p, PDBe:1m4p, PDBj:1m4p
PDBsum1m4p
PubMed12379843
UniProtQ99816|TS101_HUMAN Tumor susceptibility gene 101 protein (Gene Name=TSG101)

[Back to BioLiP]