Structure of PDB 1m46 Chain A Binding Site BS01

Receptor Information
>1m46 Chain A (length=148) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SATRANKDIFTLFDKKGQGAIAKDSLGDYLRAIGYNPTNQLVQDIINADS
SLRDASSLTLDQITGLIEVNEKELDATTKAKTEDFVKAFQVFDKESTGKV
SVGDLRYMLTGLGEKLTDAEVDELLKGVEVDSNGEIDYKKFIEDVLRQ
Ligand information
>1m46 Chain B (length=25) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SVLRTITNLQKKIRKELKQRQLKQE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1m46 Two distinct myosin light chain structures are induced by specific variations within the bound IQ motifs-functional implications
Resolution2.103 Å
Binding residue
(original residue number in PDB)		F86 A89 L113 E115 L117 E121 Q149
Binding residue
(residue number reindexed from 1)		F85 A88 L112 E114 L116 E120 Q148
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0031489 myosin V binding
GO:0032038 myosin II heavy chain binding
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0000920 septum digestion after cytokinesis
GO:0006903 vesicle targeting
GO:0030050 vesicle transport along actin filament
GO:0031991 regulation of actomyosin contractile ring contraction
GO:0032465 regulation of cytokinesis
GO:0051301 cell division
GO:1903338 regulation of cell wall organization or biogenesis
GO:1903475 mitotic actomyosin contractile ring assembly
GO:1903476 protein localization to cell division site involved in mitotic actomyosin contractile ring assembly
Cellular Component
GO:0000142 cellular bud neck contractile ring
GO:0005886 plasma membrane
GO:0005934 cellular bud tip
GO:0005935 cellular bud neck
GO:0016459 myosin complex
GO:0016460 myosin II complex
GO:0030427 site of polarized growth
GO:0031475 myosin V complex
GO:0031982 vesicle
GO:0120155 MIH complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1m46, PDBe:1m46, PDBj:1m46
PDBsum1m46
PubMed12554638
UniProtP53141|MLC1_YEAST Myosin light chain 1 (Gene Name=MLC1)

[Back to BioLiP]