Structure of PDB 1m27 Chain A Binding Site BS01

Receptor Information
>1m27 Chain A (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGY
IYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQY
PVEK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1m27 SAP couples Fyn to SLAM immune receptors.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R13 E17 Y50 I51 Y52 T53 Y54 R55 E67 A69 V72 D91 G93
Binding residue
(residue number reindexed from 1)		R13 E17 Y50 I51 Y52 T53 Y54 R55 E67 A69 V72 D91 G93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006968 cellular defense response
GO:0007267 cell-cell signaling
Cellular Component
GO:0005737 cytoplasm

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1m27, PDBe:1m27, PDBj:1m27
PDBsum1m27
PubMed12545174
UniProtO60880|SH21A_HUMAN SH2 domain-containing protein 1A (Gene Name=SH2D1A)

[Back to BioLiP]