Structure of PDB 1m0v Chain A Binding Site BS01

Receptor Information
>1m0v Chain A (length=130) Species: 633 (Yersinia pseudotuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNLSLSDLHRQVSRLVQQESGDCTGKLRGNVAANKETTFQGLTIASGARE
SEKVFAQTVLSHVANVVLTQEDTAKLLQSTVKHNLNNYDLRSVGNGNSVL
VSLRSDQMTLQDAKVLLEAALRQESGARGS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1m0v Solution structure and phosphopeptide binding to the N-terminal domain of Yersinia YopH: comparison with a crystal structure
ResolutionN/A
Binding residue
(original residue number in PDB)		L3 R10 Q11 R14 K26 R28 N30
Binding residue
(residue number reindexed from 1)		L3 R10 Q11 R14 K26 R28 N30
Enzymatic activity
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
Gene Ontology
Molecular Function
GO:0004725 protein tyrosine phosphatase activity
Biological Process
GO:0006470 protein dephosphorylation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1m0v, PDBe:1m0v, PDBj:1m0v
PDBsum1m0v
PubMed12234185
UniProtP08538|YOPH_YERPS Tyrosine-protein phosphatase YopH (Gene Name=yopH)

[Back to BioLiP]