Structure of PDB 1m07 Chain A Binding Site BS01

Receptor Information

>1m07 Chain A (length=111) Species: 8400 (Aquarana catesbeiana)

QNWATFQQKHIINTPIINCNTIMDNNIYIVGGQCKRVNTFIISSATTVKA
ICTGVINMNVLSTTRFQLNTCTRTSITPRPCPYSSRTETNYICVKCENQY
PVHFAGIGRCP

Ligand information

>1m07 Chain C (length=4)

acga

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1m07 Residues involved in the catalysis, base specificity, and cytotoxicity of ribonuclease from Rana catesbeiana based upon mutagenesis and X-ray crystallography
• Resolution: 1.8 Å
• Binding residue (original residue number in PDB): E1 K9 H10 K35 V37 N38 T39 K95 E97 V102 H103 F104
• Binding residue (residue number reindexed from 1): E1 K9 H10 K35 V37 N38 T39 K95 E97 V102 H103 F104

Enzymatic activity

• Enzyme Commision number: 3.1.27.-

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0004519 endonuclease activity
• GO:0004540 RNA nuclease activity
• GO:0030246 carbohydrate binding

Biological Process

• GO:0050830 defense response to Gram-positive bacterium

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:1m07, PDBe:1m07, PDBj:1m07
• PDBsum: 1m07
• PubMed: 12499382
• UniProt: P11916|RNASO_AQUCT Oocytes ribonuclease (Gene Name=RCR)