Structure of PDB 1m05 Chain A Binding Site BS01

Receptor Information
>1m05 Chain A (length=269) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAAPWIEQEGPE
YWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGR
LLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRA
YLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGF
YPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYT
CHVQHEGLPKPLTLRWEPS
Ligand information
>1m05 Chain E (length=9) Species: 10377 (Human herpesvirus 4 strain B95-8) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FLRGRAYGL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1m05 The structure of HLA-B8 complexed to an immunodominant viral determinant: peptide-induced conformational changes and a mode of MHC class I dimerization.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Y7 D9 Y59 N63 I66 N70 T73 D74 S77 N80 Y84 Y99 N114 Y116 Y123 T143 K146 W147 A150 V152 D156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 D9 Y51 N55 I58 N62 T65 D66 S69 N72 Y76 Y91 N106 Y108 Y115 T135 K138 W139 A142 V144 D148 Y151 W159 Y163
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1m05, PDBe:1m05, PDBj:1m05
PDBsum1m05
PubMed12391232
UniProtP01889|HLAB_HUMAN HLA class I histocompatibility antigen, B alpha chain (Gene Name=HLA-B)

[Back to BioLiP]