Structure of PDB 1lxg Chain A Binding Site BS01

Receptor Information
>1lxg Chain A (length=71) Species: 8649 (Naja kaouthia) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKT
GVDIQCCSTDNCNPFPTRKRP
Ligand information
>1lxg Chain B (length=18) Species: 7787 (Tetronarce californica) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YRGWKHWVYYTCCPDTPY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1lxg NMR-based Binding Screen and Structural Analysis of the Complex Formed between alpha-Cobratoxin and an 18-mer Cognate Peptide Derived from the alpha1 Subunit of the Nicotinic Acetylcholine Receptor from Torpedo californica
ResolutionN/A
Binding residue
(original residue number in PDB)		D8 I9 T10 I32 R33 G34 K35 R36 R68 K69
Binding residue
(residue number reindexed from 1)		D8 I9 T10 I32 R33 G34 K35 R36 R68 K69
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0030550 acetylcholine receptor inhibitor activity
GO:0090729 toxin activity
GO:0099106 ion channel regulator activity
Biological Process
GO:0035821 modulation of process of another organism
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1lxg, PDBe:1lxg, PDBj:1lxg
PDBsum1lxg
PubMed12133834
UniProtP01391|3L21_NAJKA Alpha-cobratoxin

[Back to BioLiP]