Structure of PDB 1lrr Chain A Binding Site BS01

Receptor Information
>1lrr Chain A (length=118) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TIKDKVRAMRELLLSDEYAEQKRAVNRFMLLLSTLYSLDAQAFAEATESL
HGRTRVYFAADEQTLLKNGNQTKPKHVPGTPYWVITNTNTGRKCSMIEHI
MQSMQFPAELIEKVCGTI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1lrr Insights into negative modulation of E. coli replication initiation from the structure of SeqA-hemimethylated DNA complex
Resolution2.65 Å
Binding residue
(original residue number in PDB)		G115 R116 T117 R118 Y120 N133 Q134 N150 R155
Binding residue
(residue number reindexed from 1)		G52 R53 T54 R55 Y57 N70 Q71 N87 R92
Binding affinityPDBbind-CN: Kd=7uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1lrr, PDBe:1lrr, PDBj:1lrr
PDBsum1lrr
PubMed12379844
UniProtP0AFY8|SEQA_ECOLI Negative modulator of initiation of replication (Gene Name=seqA)

[Back to BioLiP]