Structure of PDB 1lop Chain A Binding Site BS01

Receptor Information
>1lop Chain A (length=164) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVTFHTNHGDIVIKTFDDKAPETVKNFLDYCREGFYNNTIFHRVINGFMI
QGGGFEPGMKQKATKEPIKNEANNGLKNTRGTLAMARTQAPHSATAQFFI
NVVDNDFLNFSGESLQGWGYCVFAEVVDGMDEVDKIKGVATGRSGMHQDV
PKEDVIIESVTVSE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1lop The substrate-binding site in Escherichia coli cyclophilin A preferably recognizes a cis-proline isomer or a highly distorted form of the trans isomer.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		R43 I45 F48 A86 R87 Y120
Binding residue
(residue number reindexed from 1)		R43 I45 F48 A86 R87 Y120
Enzymatic activity
Catalytic site (original residue number in PDB) R43 F48 Q51 R87 F99 L108 Y120
Catalytic site (residue number reindexed from 1) R43 F48 Q51 R87 F99 L108 Y120
Enzyme Commision number 5.2.1.8: peptidylprolyl isomerase.
Gene Ontology
Molecular Function
GO:0003755 peptidyl-prolyl cis-trans isomerase activity
GO:0005515 protein binding
Biological Process
GO:0000413 protein peptidyl-prolyl isomerization
GO:0006457 protein folding
GO:0061077 chaperone-mediated protein folding
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1lop, PDBe:1lop, PDBj:1lop
PDBsum1lop
PubMed8601841
UniProtP23869|PPIB_ECOLI Peptidyl-prolyl cis-trans isomerase B (Gene Name=ppiB)

[Back to BioLiP]