Structure of PDB 1lo1 Chain A Binding Site BS01

Receptor Information

>1lo1 Chain A (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AIPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECE
ITKRRRKSCQACRFMKALKVGMLKEGVRLDRVRGGRQKYK

Ligand information

>1lo1 Chain B (length=13) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gctcaaggtcacg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1lo1 Monomeric Complex of Human Orphan Estrogen Related Receptor-2 with DNA: A Pseudo-dimer Interface Mediates Extended Half-site Recognition
Resolution	N/A
Binding residue (original residue number in PDB)	R101 Y113 H114 Y115 K124 K128 Q132 R174 R177 V178 R179 G180 R182 Q183 K184
Binding residue (residue number reindexed from 1)	R5 Y17 H18 Y19 K28 K32 Q36 R78 R81 V82 R83 G84 R86 Q87 K88
Binding affinity	PDBbind-CN: Kd=7.1nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0008270	zinc ion binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1lo1, PDBe:1lo1, PDBj:1lo1
PDBsum	1lo1
PubMed	12654265
UniProt	O95718\|ERR2_HUMAN Steroid hormone receptor ERR2 (Gene Name=ESRRB)

[Back to BioLiP]