Structure of PDB 1lli Chain A Binding Site BS01

Receptor Information
>1lli Chain A (length=89) Species: 10710 (Lambdavirus lambda) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKPLTQEQLEDARRLKAIYEKKKNELGLSQESLADKLGMGQSGIGALFNG
INALNAYNAALLAKILKVSVEEFSPSIAREIYEMYEAVS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1lli The crystal structure of a mutant protein with altered but improved hydrophobic core packing.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		Y22 Q33 Q44 N52
Binding residue
(residue number reindexed from 1)		Y19 Q30 Q41 N49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1lli, PDBe:1lli, PDBj:1lli
PDBsum1lli
PubMed8278404
UniProtP03034|RPC1_LAMBD Repressor protein cI (Gene Name=cI)

[Back to BioLiP]