Structure of PDB 1lkl Chain A Binding Site BS01

Receptor Information
>1lkl Chain A (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQ
NQGEVVKHYKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSR
PCQT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1lkl Crystal structures of the human p56lck SH2 domain in complex with two short phosphotyrosyl peptides at 1.0 A and 1.8 A resolution.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		R134 R154 S156 E157 S158 S164 H180 Y181 K182 S194
Binding residue
(residue number reindexed from 1)		R12 R32 S34 E35 S36 S42 H58 Y59 K60 S72
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:1lkl, PDBe:1lkl, PDBj:1lkl
PDBsum1lkl
PubMed8604142
UniProtP06239|LCK_HUMAN Tyrosine-protein kinase Lck (Gene Name=LCK)

[Back to BioLiP]